PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00657.1_g00015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 287aa    MW: 30317.3 Da    PI: 6.256
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00657.1_g00015.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.29.1e-091256345
                             SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                             +W+ ++d  + +a + +  +    W++Ia+ ++ g++ +q+k+++ 
  Rsa1.0_00657.1_g00015.1 12 AWSRDDDIAFERALASYTDEseeKWEKIAADVP-GKSVEQIKEHYE 56
                             8*****************99*************.**********95 PP

2Myb_DNA-binding42.12.1e-13118162347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +WT++E+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
  Rsa1.0_00657.1_g00015.1 118 AWTEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKY 162
                              6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.487863IPR017884SANT domain
SMARTSM007174.2E-8961IPR001005SANT/Myb domain
CDDcd001672.72E-81259No hitNo description
PfamPF002491.5E-71256IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-41257IPR009057Homeodomain-like
SuperFamilySSF466897.9E-101366IPR009057Homeodomain-like
PROSITE profilePS5129417.581110167IPR017930Myb domain
SuperFamilySSF466891.2E-16113168IPR009057Homeodomain-like
SMARTSM007173.2E-10115165IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.5E-17115165IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.3E-10118161IPR009057Homeodomain-like
PfamPF002492.6E-11118162IPR001005SANT/Myb domain
CDDcd001677.73E-10118163No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MTVEEVSDGS SAWSRDDDIA FERALASYTD ESEEKWEKIA ADVPGKSVEQ IKEHYELLVE  60
DVSNIESGCV PLPSYGSPQG GSTGGGGDDG GSTKKGGGNE SNQGSKAKAD QERRKGIAWT  120
EDEHRLFLLG LDKYGKGDWR SISRNFVVTR TPTQVASHAQ KYFIRLNSMN KERRRTSIHD  180
ITSVGDADVS TPQGPITGQN NNNNNNNGSA SAAAAVAGGG GGNKPAKQAA SQPPPTYGTP  240
SIGQPVVGTP VSLPAPPHMA FAAPVPGAPV NMSQMPYTMP RTPTAHR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A7e-1613801178RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399351.11e-161hypothetical protein EUTSA_v10014203mg
SwissprotQ8S9H71e-59DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLE4MWT41e-161E4MWT4_EUTHA; mRNA, clone: RTFL01-15-N01
TrEMBLV4LAV41e-161V4LAV4_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.6__825__AT5G08520.11e-160(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35562861
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-138MYB family protein